McDonnell Genome Institute

Washington University

CircRNA

chr11|71094536|71113364|-|SHANK2|ENST00000601538.5

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9819

29

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

7

Peptide

QASLDEK

Amino Acids from 5' Exons

RPPPPLSWTTLWRSSKLSKMVELTWTSVPKMGPPYTKLPERGTKLP,DPPDLSRSAGRLCGGHQSSQKWWSSPGLPCQRWDDRPTQSCPSEEPSCPE,TPLTLAAQLDDSVEVIKALKNGGAHLDFRAKDGMTALHKAARARNQVALK

Amino Acids from 3' Exons

FRYKKRVYKQASLDEKQLAKLHTK,FDTRSGCINKPVSMRNSWPSSTR,SIQEAGVTSQSRETVGQAPHE