McDonnell Genome Institute

Washington University

CircRNA

chr11|709329|720223|+|EPS8L2|ENST00000318562.12

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9994

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

2

Peptide

HWPQTGATLR

Amino Acids from 5' Exons

VWDRHWPQTGATLRSALLPLAATQDTMSQSGAVSCCPGAT,CGTGTGLRPGPHGLPFSRWPPPKTPASPGPAAARVPP,VGQALASDRGHTEVCPSPAGRHPRHHEPVRGRELLPGCHQ

Amino Acids from 3' Exons

HLATFIMDKSEAITSVDDAIRKLVQLSSKEKIWTQEMLLQVNDQSLRLLDIESQ,TWPHSSWTRAKPSRLWTTPSGSWCSAPRRRSGPRRCCCRTTSRCGCWTSSH,PGHIHHGQERSHHVCGRRHPEAGAAELQGEDLDPGDAAAGERPVAAAAGHRVT