McDonnell Genome Institute

Washington University

CircRNA

chr11|70659827|71147338|-|SHANK2|ENST00000601538.5

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9985

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

10

Peptide

ATAEKPGGAR

Amino Acids from 5' Exons

LTHPLKNSHQHRLSQPYSTWSPWMKVGWRGKPDGPGTSL,HTHRIHTNTGFPSPTVPGVRGRWGGVASRTKDRGLLD,DTPIEEFTPTPAFPALQYLESVDEGGVAWQAGLRTGDFLIE

Amino Acids from 3' Exons

TQAAMPRSPTSSEDEMAQSFSDYSVGSESDSSKEETIYDTIRATAEKPGGARTEESQGNTLVIRVVIHDLQQT,HRQPCRAAQHPARTRWPRASPTTPWGRSQTAPKKRPSMTRSGPLRRSRAVPGRRRARATRWSAWSSMTCSR,TGSHAAQPNIQRGRDGPELLRLLRGVGVRQLQRRDHLHDPGHCGEAGRCQDGGEPGQHAGDPRGHPPAAD