McDonnell Genome Institute

Washington University

CircRNA

chr11|70659827|71119032|-|SHANK2|ENST00000601538.5

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9999

12

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

10

Peptide

ILCTLTQSLK

Amino Acids from 5' Exons

LTHPLKNSHQHRLSQPYSTWSPWMKVGWRGKPDGPGTSL,HTHRIHTNTGFPSPTVPGVRGRWGGVASRTKDRGLLD,DTPIEEFTPTPAFPALQYLESVDEGGVAWQAGLRTGDFLIE

Amino Acids from 3' Exons

KCIRFNPDATVWVAKQRILCTLTQSLKDVLNYGLFQPASNGRDGKFLDEERLLREYPQPVGEGVPSLE,NAFDLTRMPQCGLQSSGSCVHPRVKMSTTACSSRPAMGVTASSWMRSGSCASTHSPWVRAFLPW,MHSIPGCHSVGCKAADPVYINPEFERCPELRPVPAGQQWARQVPGGAAPARVPTARGGRSFPG