McDonnell Genome Institute

Washington University

CircRNA

chr11|70422939|70433278|+|CTTN|ENST00000301843.12

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9996

7

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

27

Peptide

EASSQQGLAYATEAVYESAEAPGHYPADYSK

Amino Acids from 5' Exons

TTPKDSAGSMGCRRIGWI,LLQRIRREVWGAEGSDG,YSKGFGGKYGVQKDRMDK

Amino Acids from 3' Exons

DAASFKAELSYRGPVSGTEPEPVYSMEAADYREASSQQGLAYATEAVYESAEAPGHYPA,MRLPSRQSATEALVGRSRSPCTAWRPLTTERPAASRAWPMPQRLSMKAQRPRATIPQ,CGFLQGRAELQRPCEWDGAGARVQHGGRLPRGQQPAGPGLCHRGCLKRRGPGPLSR