McDonnell Genome Institute

Washington University

CircRNA

chr11|70409830|70414652|+|CTTN|ENST00000301843.12

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9423

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

11

Peptide

SVASEASLVSR

Amino Acids from 5' Exons

HTQAEGECLSRASDPGEGTNRTKSFPWLWREIWCGTRPNG,IHKLRENVFQEHQTLKEKELETGPKASHGYGGKFGVEQDRMDK,YTSGRMSFKSIRPLRRRNLKQDQKLPMAMEGNLVWNKTEWI

Amino Acids from 3' Exons

SAVGHEYQSKLSKHCSQVDSVRGFGGKFGVQMDRVDQ,QLSATNISRNFPSTARRWTRSVASEASLVSRWTELI,SCRPRISVETFQALLAGGLGPWLRRQVWCPDGQSS