McDonnell Genome Institute

Washington University

CircRNA

chr11|70343668|70376600|+|PPFIA1|ENST00000253925.11

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9277

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

11

4

Peptide

RFDEVQTLNEQDWER

Amino Acids from 5' Exons

VQTLNEQDWERAQQASVLANVAQAFESDADVSDGEDDRDTLLSSVDLLSPSGQADAHTLAMMLQEQLDAINKEI,YKLLMSRIGNVPSKLVSWQMHKHSRVMLTCLMVKMTGTLSSAQLTCYRPAGRPTRTHPCFRSSWTPSTKRS,TNSAGLGTCPASCLGKCSTSIRECRVWRQGHSPQLSPAIAQRAGRRAHTSHDASGAAGRHQQRDQ

Amino Acids from 3' Exons

ARAVLEREFNNLLVMGTDRRFDE,LVLSWKENLTTFWSWGLIEGLM,SCCLGKRIQPFGHGDKV