McDonnell Genome Institute

Washington University

CircRNA

chr11|70325499|70348420|+|PPFIA1|ENST00000253925.11

Cancer

Type of Peptide

PRAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.961

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

6

Peptide

LGVMTLVR

Amino Acids from 5' Exons

VRERLRVALERCSLLEEELGATHKE,ESDYEHLKDVVCKRNVPHTK,ERAITSSTKMFVRRGIRCHTQR

Amino Acids from 3' Exons

VDSGRKRKYRAAGRGDKSSWQWKSRQSWSFINELHSPLPCFLACLLPSGQWALHPTKDPSQPSSGSGQTGRHDP,LIQEEKENTEQRAEEIESRVGSGSLDNLGRFRSMSSIPPYPASSLASSSPPGSGRSTPRRIPHSPAREVDRLGVMTL,FRKKKKIQSSGQRRLKVELAVEVTILVVLDQAPFPPTLLPRLLAPPLRAVGAPPHEGSLTAQLGKWTDWASP