McDonnell Genome Institute

Washington University

CircRNA

chr11|69643030|69643991|+|CCND1|ENST00000227507.2

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9999

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

17

3

Peptide

GGGLPAGHELPGPLPVAGAR

Amino Acids from 5' Exons

VCEEQKCEEEVFPLAMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLTAEKLCIYTDNSIRPEELL,SARNRSARRRSSRWPTTWTASCRWSPKRAACSCWGPLACSWPLRRRPSPRPRSCASTPTTPSGPRSC,LRGTEVRGGGLPAGHELPGPLPVAGAREKEPPAAAGGHLHVRGLDEGDHPPDGREAVHLHRQLHPARGAA

Amino Acids from 3' Exons

QMELLLVNKLKWNLAAMTPHDFIEHFLSKMPEAEENKQIIRKHAQTFVALCAT,KWSCSWTSSSGTWPQPRTISLNTSSPKCQRRRRTNRSSANTRRPSLPSVPQ,NGAAPGEQAQVEPGRNDPARFHTLPLQNARGGGEQTDHPQTRADLRCPLCH