McDonnell Genome Institute

Washington University

CircRNA

chr11|68794803|68804101|-|CPT1A|ENST00000265641.9

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9039

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

4

Peptide

EEIKPGMVK

Amino Acids from 5' Exons

DLLYILPTHIQAARAGNAIHAILLYRRKLDREEIKP,ICCISFQLTFRQQEPATPSMPSCFTGANWTGRKSN,SAVYPSNSHSGSKSRQRHPCHPALQAQTGPGGNQT

Amino Acids from 3' Exons

GMVKIFSGRKPMLYSFQTSLPRLPVPAVKDTVNR,VWSRSFQAENPCCTASRHRCLACRSRLSKTLT,YGQDLFRPKTHVVQLPDIAASPAGPGCQRHCEQ