McDonnell Genome Institute

Washington University

CircRNA

chr11|67584133|67585241|+|GSTP1|ENST00000494593.1

Cancer

Type of Peptide

OSCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9756

7

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

7

Peptide

SMCLAGK

Amino Acids from 5' Exons

CRPTPWSISQFEVGACVWQGREAGAGAAAHSPSPTRRDPNPLIPPSCGFYPGPPSCSPPLPPCLLPAPVLCEIFGGTCFPVPSLHSPLPGLLRGGVGPVPTSRTSPSPQAAARPCACCWQIRARAGRRRWPWRRGRRAHSKPPAVTMPGQGEGVLGLRGLLGSGDAQAQCPSLSHASPNSYTGSSPSSRTETSPCTSPIPSCVTWAAPLVSLEPPSPGQAWASLCPRSPFVISCPAALWSGGNDPLRLRSLPKVKPGCLQSLPCARLPPRCQVSSEHLLCGSLSSFHAHPLPLLPGWGSQTAPWLAHPQLCVDQAPSHAACSPPPNPRALWEGPAGGSPGGHGERRGGPPLQIHLPHLHQL,AALHRGLFPSSREHVSGREGRQGLGLQPTAPRPPGEIRTPLSLRRVAFTPGLLPVPRLSRHACSPPQCCVKSSEEPVSLFPPCTPDPSPGCCEAESARSPHLVLLPPRRPLRGPAHAAGRSGPELEGGGGDRGDVAGGLTQSLLRKPCPGKGRGCWALGGCDDRGTPKLSAPPAMPPPTAIRAAPQVPGRRPHPVPVQYHPASPGPHPWVLNLQVQGRHGQASAPGALLFKSAAPQPSGVEETETHGYVVCPRSSLGACNPCPVPGCLPGVRALSTCCVAVSHPSTHILFPSSQAGAHRQPPGWPIPSDCVLIRRPVTRPAPLHPTPGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNY,PPYTVVYFPVRGRSMCLAGKGGRGWGCSPQPLAHPERSEPPYPSVVWLLPRASFLFPASPAMPAPRPSVVNLRRNLFPCSLPALLTPPRVAARRSRPGPHISYFSLPAGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCVSDHARARGGGAGPGAVTRIGGRPSSVPLPEPCLPQQLYGQLPKFQDGDLTLYQSNTILRHLGRTLGESTSKSRAGMGKPLPPEPFCLNQLPRSPLEWRKLRPTEVTFAQGQAWVPAILALCQAASQVSGELAPAVWQSLILPRTSSSPPPRLGLTDSPLVGPSPVTVCSGAQSRGLLPSTQPQGSMGRTSRRQPWWTWMTAWRTSAANTSPSSTPT

Amino Acids from 3' Exons

CRPTPWSISQFEVGACVWQGREAGAGAAAHSPSPTRRDPNPLIPPSCGFYPGPPSCSPPLPPCLLPAPVLCEIFGGTCFPVPSLHSPLPGLLRGGVGPVPTSRTSPSPQAAARPCACCWQIRARAGRRRWPWRRGRRAHSKPPAVTMPGQGEGVLGLRGLLGSGDAQAQCPSLSHASPNSYTGSSPSSRTETSPCTSPIPSCVTWAAPLVSLEPPSPGQAWASLCPRSPFVISCPAALWSGGNDPLRLRSLPKVKPGCLQSLPCARLPPRCQVSSEHLLCGSLSSFHAHPLPLLPGWGSQTAPWLAHPQLCVDQAPSHAACSPPPNPRALWEGPAGGSPGGHGERRGGPPLQIHLPHLHQL,AALHRGLFPSSREHVSGREGRQGLGLQPTAPRPPGEIRTPLSLRRVAFTPGLLPVPRLSRHACSPPQCCVKSSEEPVSLFPPCTPDPSPGCCEAESARSPHLVLLPPRRPLRGPAHAAGRSGPELEGGGGDRGDVAGGLTQSLLRKPCPGKGRGCWALGGCDDRGTPKLSAPPAMPPPTAIRAAPQVPGRRPHPVPVQYHPASPGPHPWVLNLQVQGRHGQASAPGALLFKSAAPQPSGVEETETHGYVVCPRSSLGACNPCPVPGCLPGVRALSTCCVAVSHPSTHILFPSSQAGAHRQPPGWPIPSDCVLIRRPVTRPAPLHPTPGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNY,PPYTVVYFPVRGRSMCLAGKGGRGWGCSPQPLAHPERSEPPYPSVVWLLPRASFLFPASPAMPAPRPSVVNLRRNLFPCSLPALLTPPRVAARRSRPGPHISYFSLPAGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCVSDHARARGGGAGPGAVTRIGGRPSSVPLPEPCLPQQLYGQLPKFQDGDLTLYQSNTILRHLGRTLGESTSKSRAGMGKPLPPEPFCLNQLPRSPLEWRKLRPTEVTFAQGQAWVPAILALCQAASQVSGELAPAVWQSLILPRTSSSPPPRLGLTDSPLVGPSPVTVCSGAQSRGLLPSTQPQGSMGRTSRRQPWWTWMTAWRTSAANTSPSSTPT