McDonnell Genome Institute

Washington University

CircRNA

chr11|67398939|67400919|-|PPP1CA|ENST00000312989.11

Cancer

Type of Peptide

BRCA-Luminal A

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9029

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

14

3

Peptide

LFYLWSRGGGQVPPQAR

Amino Acids from 5' Exons

ACPRTCSLWSRFGGSCGPQMCLTRACCVTCCGLTLTRTCRAGARTTVASLLPLEPRWWPSSSTSTTWTSSAEHT,PVPGPAVYGADSADHAAHRCAPGPAVPAVVPQGRAGLGRERPWRLFYLWSRGGGQVPPQARLGPHLPSTP,LSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQ

Amino Acids from 3' Exons

VTYTASTTTFCDYLSMAVSLPRATTSFWGTMWTGASSPWRPSACCWPIRSSTPRTSSCSVGTTSVPASTASMVSTMS,HTRPVLRPSATIVWRFPSREQLPLSGGLCGQGQAVLGDHLPAAGLDQVPRELLPAPWEPRVCQHQPHLWFLR,DIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDE