McDonnell Genome Institute

Washington University

CircRNA

chr11|67279199|67282542|+|ADRBK1|ENST00000416281.6

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9376

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

13

Peptide

ATLWVQVVAGDRR

Amino Acids from 5' Exons

GTCSSETSATTWRRPGPWWNSMR,VPALPRLLPEPPGGGQALGGILG,YLLFRDFCLNHLEEARPLVEFYEE

Amino Acids from 3' Exons

VGTCTTTSPSTGSSQRLTCASMRPRSSWAWSTCTTASWSTGTRAPLLSPGWTSVAVLSFLSTSRPPGPEEWGSWDMAAPYLPISAPALPTEPLSGSRLLGTGERTPTFALSLGTHRPLQSSDPAGILPGWAPSAAPGSSLGFLHSQPTSFWTSMATCGSRTWAWPVTSPRRSPMPACECPPPSPSPPLATPAYGPLAPTGAPTGTWLRRSCRRAWPTTAVPTGSLWGACSSSCCG,WGPALPPLPARGLLRGHALLCGRDHPGPGAHAQPLRGLPGPEGERPCCPQAGPPWLSSPSSRHPGHQAQRSGAPGTWPPRIFPSPPLPFPPSHSLGPGCSWGQERGPPPLPFLWVPIVLSSEAVTQLASCLAGPHPELPQAAHWASFTASQHPSGRAWPRADLGPGPGLLLQEEAPCQRVSAPHPLPPHPLPLPLMAPLLPQGHPRVHGSGGPAEGRGLRQQCRLVLSGVHALQVAAG,GDLHYHLSQHGVFSEADMRFYAAEIILGLEHMHNRFVVYRDLKVSAPAVPRLDLRGCPLLPLDIPATRPRGVGLLGHGRPVSSHLRPCPSHRATLWVQVVAGDRREDPHLCPFFGYPSSSPVKQPSWHLAWLGPILSCPRQLTGLPSQPANILLDEHGHVRISDLGLACDFSKKKPHASVVPPTLSLPTPCHSRLWPPCSHRGTHGYMAPEVLQKGVAYDSSADWFSLGCMLFKLLR