McDonnell Genome Institute

Washington University

CircRNA

chr11|67180078|67207688|+|KDM2A|ENST00000308783.9

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9808

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

10

Peptide

LENMVQRPSTRGTMR

Amino Acids from 5' Exons

RGTMRRRYEDDGISDDEIEGKRTFDLEEKLHTNKYNANFVTFMEGK,VVPCDDAMKMMAFQMMKLKEKELLTWKRNCTPTNIMPILLLLWKEK,WYHATTLRWHFRNRKKNFLGRETAHQQICQFCYFYGRK

Amino Acids from 3' Exons

GVVAWWMSWTTHRKALKPWLSGHATMRPQRRSERNSIMSSASSLATPGWRIWCRGPP,ESSHGGCHGREHTERHNDHGSVDTLLDPRGGARETLCHQPRVPHQAGEYGAEALH,SRRMVDVMDVNTQKGIEMTMAQWTRYYETPEEEREKLYNVISLEFSHTRLENMVQRPST