McDonnell Genome Institute

Washington University

CircRNA

chr11|66566021|66567321|-|CTSF|ENST00000310325.9

Cancer

Type of Peptide

GBM

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9839

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

5

Peptide

DQDLPVK

Amino Acids from 5' Exons

RRSSALSTILSGKSLATRSKPSLWVTSPHLNGTGGVRGLSQKSKT,GGVPHYLPEYSPEERAWQQDEASQVCGPRPTMGLEEGGCHKSQRP,EEFRTIYLNTLLRKEPGNKMKQAKSVGDLAPPEWDWRSKGAVTKVKDQ

Amino Acids from 3' Exons

DLPVKMASIFKNFVITYNRTYESKE,TCLRWLQSSRTLSLPITGHMSQRK,LACEDGFNLQELCHYLPDIVKG