McDonnell Genome Institute

Washington University

CircRNA

chr11|65387036|65405068|+|FRMD8|ENST00000317568.9

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9903

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

12

Peptide

IQHLSTIDYVEDDGR

Amino Acids from 5' Exons

MDGTEGSAGQPGPAERSHRSSVSSVGAR,WTGQKAVPGSPAPLSDPTEAACPPWEPE,GRDRRQCRAARPRAIPPKQRVLRGSP

Amino Acids from 3' Exons

AELMSSLIEYCIELSQAAEPAGPQDSATGSPSDPSSSLAPVQRPKLRRQGSVVSSRIQHLSTIDYVED,PNAVSLSTASNARRRSPQAPRTVRLARPRTPAPHWLLFSAPSCGGRAVWCPAGSSISPPSTTWRT,RTDEQSHVLHRTEPGGGARRPPGQCDWLALGPQLLTGSCSAPQAAEAGQCGVQPDPASLHHRLRGG