McDonnell Genome Institute

Washington University

CircRNA

chr11|65182700|65183592|+|CAPN1|ENST00000279247.10

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9988

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

21

9

Peptide

MAMPASSISRMSEEIITPVYCTGVSAQVQK

Amino Acids from 5' Exons

DVGGDHHAGVLHWGVSPSAEAAGQGAGPGPPECHQVPGPGLAAAGAMPAEWDPLPGLPPGTPEPGLQGPGSQFLQDLWHQVEASH,MSEEIITPVYCTGVSAQVQKQRARELGLGRHENAIKYLGQDYEQLRVRCLQSGTLFRDEAFPPVPQSLGYKDLGPNSSKTYGIKWKRPT,CRRRSSRRCTALGCQPKCRSSGPGSWAWAAMRMPSSTWARIMSSCGCDACRVGPSSVMRPSPRYPRAWVTRTWVPIPPRPMASSGSVP

Amino Acids from 3' Exons

GTAGSWRPSPPSLSTTPSCTEWFRTARASRMAMPASSIS,GLLALGGHRLPHSQRHPPAPSGSARPELPEWLCRHLPFP,DCWLLAAIASLTLNDTLLHRVVPHGQSFQNGYAGIFHFQ