McDonnell Genome Institute

Washington University

CircRNA

chr11|65132921|65133252|-|SYVN1|ENST00000294256.12

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9835

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

15

Peptide

VDFVLYIQAFVLVFLLGK

Amino Acids from 5' Exons

HLLERSWYAVTETCLAFTVFRDDFSPRFVALFTLLLFLKCFHWLAEDRVDF,TFWNVPGTPSQRLVWPSPFFGMTSAPALLHSSLFFSSSNVSTGWLRTVWT,PSGTFLVRRHRDLSGLHRFSGLQPPLCCTLHSSSLPQMFPLAGGPCGL

Amino Acids from 3' Exons

VLYIQAFVLVFLLGKVMGKVFFGQLRAAEME,SCTSRPLSLSSFWARWARCSLGNGQQRW,PVHPGLCPCLPSGQGDGQGVLWATEGSRDG