McDonnell Genome Institute

Washington University

CircRNA

chr11|65027317|65027636|+|ARL2-SNX15|ENST00000301886.3

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9687

20

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

7

Peptide

KSAGLAR

Amino Acids from 5' Exons

PGFTLHHREGTFQTLPWPRTRDRNSAVTCDKIPRPEEEERRPGEAAAGGGWAGGVGTARRWRPALRSAPARFHVPPGEGLPAALHSVGPQDSPQGLHRVQSNRA,DLGLRFTTEKELFRRSLGRAPGIGTALSLATKSLGQRKKSAGLARRRRAEAGPEGWGRRGGGGRRSAPLQLGFMSRQAKDDFLRHYTVSDPRTHPKGYTEYKVTAQ,TWVYASPQRRNFSDAPLAAHPGSEQRCHLRQNPARGRRAQAWRGGGGRRLGRRGGDGEEVEAGAPLRSSSVSCPARRRMTSCGTTQCRTPGLTPRATPSTKPR

Amino Acids from 3' Exons

PGFTLHHREGTFQTLPWPRTRDRNSAVTCDKIPRPEEEERRPGEAAAGGGWAGGVGTARRWRPALRSAPARFHVPPGEGLPAALHSVGPQDSPQGLHRVQSNRA,DLGLRFTTEKELFRRSLGRAPGIGTALSLATKSLGQRKKSAGLARRRRAEAGPEGWGRRGGGGRRSAPLQLGFMSRQAKDDFLRHYTVSDPRTHPKGYTEYKVTAQ,TWVYASPQRRNFSDAPLAAHPGSEQRCHLRQNPARGRRAQAWRGGGGRRLGRRGGDGEEVEAGAPLRSSSVSCPARRRMTSCGTTQCRTPGLTPRATPSTKPR