McDonnell Genome Institute

Washington University

CircRNA

chr11|64946089|64954802|-|C11orf85|ENST00000530735.5

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9998

55

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

7

Peptide

AAVSSFK

Amino Acids from 5' Exons

GQDRDFQPRPQQKEAPCGNQE,AKIGTSSQGPSKKKPPVETRR,PRGLPAKAPAKRSPLWKPG

Amino Acids from 3' Exons

RRRDRKGSHHPGAGGRERSIRLLEKLLFKDASTFRFLFPTNVTTSTLGFLLLHLLCKGTLCFSMGISLYSFSVFLVEMSAPLRLRAFCFHQFPALGSSLLLQLARKIPEDCLLPGLWETSPSQPLPGTRSGNSTVNTQTRLLCLHLNWQHLQLPYSDFIFIPFYPVPLALGFPTEEDAGDQLYKLVEAMDKELEFWGLALDSSPGIATTLCDRWQIIYQLGSLPHLENERSKLAFPLLTSQF,GEEIENKEVITQELEVGKEAYDFWKSYSLRMHPHSGFNYFLQTESQPPLDNLASSCYISFAKELYVFPWEFKACILSQFSLKCQHLGELFVFTSFQPWAALFCCSWHRERFRRTASFQGSGKPHHPNHCLVLDVQETRLIHRQGCCVFIIGNICNCLIPTSFSFLSTRFLLVFLQKKTEQVINFTNWWKQWTRSSSGGWPWIPVLAPPLSCVTVGKSYINLDLNCLIWKMRGLNLFLFLHNS,EKRKIRKSSPRSWRGKKHTTSGKVTLGCIHIQVLIISYKLSHNLHLITWLPPATSPLQRNFMFFHGNLKPVFFLSFPSNVSTFEAESFLFSPVSSLGQLSFVAAGIEKDSGGLPPSRALGNLTIPTTAWYLTFRKLDCKYTDKAAVSSFKLATFAIALFRLHFHSFLPGSSSFRFSYRRRLSRSTLQIGGSNGQGVRVLGVGPGFQSWHSHHLAVPLANHISTWILIASFGKEVTSFSSSDFTI