McDonnell Genome Institute

Washington University

CircRNA

chr11|64807178|64810132|-|MEN1|ENST00000337652.5

Cancer

Type of Peptide

PRAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9038

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

10

Peptide

RPPPAAMGLK

Amino Acids from 5' Exons

KLLWLLYDLGHLE,SCSGCSMTWDIWK,AALAALPGTSGK

Amino Acids from 3' Exons

AAAHRPPPWGRPPRRRCSRCAPSTTWCACLLPSWAERSRTWCSFPWCWASWSIFWLSTASSLPTFPSSPSSPAPPPTRLAASPTFPWPTCLSSPPSMPASPPRSEAPSTCPSILEKGVSPAVSWRRSPMSYGTASAAPTSRIGPTSSPSSASSQVGAQ,PPPTARRHGAEGRPEDAVPAALHRRRGAPVCCRAGPRGAGPGAPFLGAGLRGAFSGCQPRHPYQRSRAHLPAQPRPRPAWRPHLLSRGRPVYHRRPLCPLHRPDPRRRRPVPLSSRRGCLQPAGEEGLRCHMEQPQPLLLQGSGPHPVPLQLHHRLEPS,RRPPPAAMGLKAAQKTLFPLRSIDDVVRLFAAELGREEPDLVLLSLVLGFVEHFLAVNRVIPTNVPELTFQPSPAPDPPGGLTYFPVADLSIIAALYARFTAQIRGAVDLSLYPREGGVSSRELVKKVSDVIWNSLSRSYFKDRAHIQSLFSFITGWSPV