McDonnell Genome Institute

Washington University

CircRNA

chr11|64648218|64713943|-|NRXN2|ENST00000265459.10

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9959

16

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

9

Peptide

AAGQPGPAR

Amino Acids from 5' Exons

APAPPALKSPVPTRASACSSGMASPATAPLPMEALSAMI,PQHHLHRVLCQPGRLLAAVGWLHLRLHHDFLWRPCLQ,PSTTCTEESCANQGVCLQQWDGFTCDCTMTSYGGPVCND

Amino Acids from 3' Exons

ASLPALLSEPAAGEGRRRRRLREAGIWASARLAPRPGPWHCEPAREPRSARGAPGPLPPHAPAALKPERGPGAGRGRGRRRHGVREPVAADTAAAAVAAAAGAGGARGRPGVRRRPRAVGSLRALGGRGEQRRAQLQPAHQRHARAAALPGRRRRLRLPGAAAGGRPPAAALHAFVRRAGHAAAGHAGGRRPLAHGAADPRRAPHGAGGGRRGPRRRGALQAARDAGGQRPVRGRHPARRAPLGAYAEHRQVRAALPRPLGQPEAGRAAPRAAGQPGPARRHRRPAVRARAQPLRQRRPLHRAGPRRGGLRLQPHGLRRQVLQR,HPSLLFCRSPRRGRGAAAAAGKPASGPLRASPRGRAHGTVSLQGSPAQRGERPAPSRPMRPRLSLSGGRGPGGAGAAVGMASGSRWRPTPPPLLLLLLLALAARADGLEFGGGPGQWARYARWAGAASSGELSFSLRTNATRALLLYLDDGGDCDFLELLLVDGRLRLRFTLSCAEPATLQLDTPVADDRWHMVLLTRDARRTALAVDGEARAAEVRSKRREMQVASDLFVGGIPPDVRLSALTLSTVKYEPPFRGLLANLKLGERPPALLGSQGLRGATADPLCAPARNPCANGGLCTVLAPGEVGCDCSHTGFGGKFCSE,IPPCSSVGARGGGGAPPPPPEGSRHLGLCAPRPAAGPMALACKGAPLSAGSARPPPAPCARGSEAAGAGGRAGPGPPAWRPGAGGGRHRRRCCCCCCWRWRRARTAWSSAAAPGSGLATRAGRARRAAASSASACAPTPRARCCSTWTTAATATSWSCCWWTAACGCASRFRAPSRPRCSWTRRWPTTAGTWCCPATRAARRWRWTARPAPPRCAPSGARCRWPATCSWAASRPTCASRRLRAPSSTSRPSAASWPTSWASGPPRCWAARACAAPPPTRCARPRATPAPTAASAPCWPPARWAATAATRASAASSAAK