McDonnell Genome Institute

Washington University

CircRNA

chr11|64349330|64349668|+|CCDC88B|ENST00000356786.9

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9316

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

10

Peptide

ALQLEEELFQELEK

Amino Acids from 5' Exons

ELEKAVVRGKELGDRLEHLQRELEQAALERQEFLREKESQHQ,SWRKLWCGARSWGTGWSICSVSWSRRLSSARNFCEKRKASTR,AGESCGAGQGVGGPAGAFAAAGAGGSRAPGISARKGKPAPE

Amino Acids from 3' Exons

VPGLGAAAGSAAGGGDQQGGGADGAQDQGPAAGRGAVP,YQGLEQRLEAELQAAATSKEEALMELKTRALQLEEELFQ,TRAWSSGWKLSCRRRRPARRRRWSSRPGPCSWKRSCS