McDonnell Genome Institute

Washington University

CircRNA

chr11|64210610|64211171|+|FERMT3|ENST00000279227.9

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.929

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

5

Peptide

VVLAGDR

Amino Acids from 5' Exons

IASRTGQTMLFGGNRRGSGCCRPTGHWTSTGSWPTHASSLGPSTGPSSFGCPTAAHCASVPASPSPSSRLWLPSAASS,SQAGLVRPCYLVGTEEAVAAADPLDTGQVRDPGRRTPLLWAPAPARHPSVAQPPRTAPPCQLLPAPLPGCGCHLPPP,RKQDWSDHAIWWEQKRQWLLQTHWTLDKYGILADARLFFGPQHRPVILRLPNRRALRLRASFSQPLFQAVAAICRLL

Amino Acids from 3' Exons

ASGTPRSCPCSGLLRRRRRRRKRRSQRKSSMTARLSWLG,HPAPRGAVPAPGSEEGEEEEREGARGRALLEQGCLGW,IRHPEELSLLRAPEKKEKKKKEKEPEEELYDLSKVVLAG