McDonnell Genome Institute

Washington University

CircRNA

chr11|64207350|64210844|+|FERMT3|ENST00000279227.9

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9637

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

11

Peptide

TPLLWAPAPAR

Amino Acids from 5' Exons

QQPQPWRGRQPPGTTSTRHGSCGCLWERRTQRPSRSPCGSLGSRTSAGCSRLWSRS,SSRSHGGDEDSLRGLHRLVMGAAGVCGRGGPRGRVGHPAGHWGVAHRRGAPEDCGAD,AAAAMAGMKTASGDYIDSSWELRVFVGEEDPEAESVTLRVTGESHIGGVLLKIVEQI,QQPQPWRGRQPPGTTSTRHGSCGCLWERRTQRPSRSPCGSLGSRTSAGCSRLWSRS,SSRSHGGDEDSLRGLHRLVMGAAGVCGRGGPRGRVGHPAGHWGVAHRRGAPEDCGAD,AAAAMAGMKTASGDYIDSSWELRVFVGEEDPEAESVTLRVTGESHIGGVLLKIVEQI

Amino Acids from 3' Exons

IASRTGQTMLFGGNRRGSGCCRPTGHWTSTGSWPTHASSLGPSTGPSSFGCPTAAHCASVPASPSPSSRLWLPSAASS,SQAGLVRPCYLVGTEEAVAAADPLDTGQVRDPGRRTPLLWAPAPARHPSVAQPPRTAPPCQLLPAPLPGCGCHLPPP,RKQDWSDHAIWWEQKRQWLLQTHWTLDKYGILADARLFFGPQHRPVILRLPNRRALRLRASFSQPLFQAVAAICRLL,IASRTGQTMLFGGNRRGSGCCRPTGHWTSTGSWPTHASSLGPSTGPSSFGCPTAAHCASVPASPSPSSRLWLPSAASS,SQAGLVRPCYLVGTEEAVAAADPLDTGQVRDPGRRTPLLWAPAPARHPSVAQPPRTAPPCQLLPAPLPGCGCHLPPP,RKQDWSDHAIWWEQKRQWLLQTHWTLDKYGILADARLFFGPQHRPVILRLPNRRALRLRASFSQPLFQAVAAICRLL