McDonnell Genome Institute

Washington University

CircRNA

chr11|64197492|64200293|+|STIP1|ENST00000305218.8

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

9

Peptide

LLEFQLALKR

Amino Acids from 5' Exons

RYTLKRATTISAGSFVRRPLKWGEKTEKTIDRLP,GILKGRLQVPGALEGHSGERKPRRLSTDCQ,VYFEKGDYNKCRELCEKAIEVGRENREDYRQIA

Amino Acids from 3' Exons

GTIPRPSIIQKPSKGTRKMPNYTAIELPATPNSWSSSWHS,GLSPGHEALYRSHQKEPERCQIIQQSSCLLHQTPGVPAGTQ,DYPQAMKHYTEAIKRNPKDAKLYSNRAACYTKLLEFQLALK