McDonnell Genome Institute

Washington University

CircRNA

chr11|63749990|63756170|+|RTN3|ENST00000339997.8

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9802

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

17

Peptide

LITMLASPEIRPSQLLK

Amino Acids from 5' Exons

CTIFSGEMRRLGLSLAPRSCCFPWQLSVSSVWFLTSSWLFSLSPSASGSTSPSSKLYRSQKKAIHS,ARSDFLERCEEDWVCLWHHADHAAFPGSFQCHQCGFLPHPGSSLCHHQLQDLQVRHPSCTEVRRRPSIQ,HDLIFWRDVKKTGFVFGTTLIMLLSLAAFSVISVVSYLILALLSVTISFRIYKSVIQAVQKSEEGHPF

Amino Acids from 3' Exons

TQIDHYVGIARDQTKSIVE,PRLITMLASPEIRPSQLLK,PDSLCWHRPRSDQVNCK