McDonnell Genome Institute

Washington University

CircRNA

chr11|62629813|62630836|-|GANAB|ENST00000346178.8

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9859

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

10

3

Peptide

DVHNIYGLYVEPR

Amino Acids from 5' Exons

GSAPNLFVWNDMNEPSVFNGPEVTMLKDAQHYGGWEHRDVHNIYGLYV,AQLPTSLSGMTTNHLCSMVLRSPCSRMPSIMGAGSTGMCITSMAFM,LSSQPLCLEHERTICVQWSGHHAQGCPALWGLGAPGCAHLWPLC

Amino Acids from 3' Exons

EPRRCPHSSPSATTRAVGTTGTRLMCWKWIRALMITTCPVMSSGTLNMLMASGISPGTPVASLSPAPCLSAWLLRGG,NPGVAPTLLPRLPPEPLELPGRGCAGSGSGLSQPALCHLARHTCWQAVFHLGPQSLPSAPHHAALGFEAE,TQALPPLFSLGYHQSRWNYRDEADVLEVDQGFDDHNLPCDVIWLDIEHADGKRYFTWDPSRFPQPRTMLERLASKRRK