McDonnell Genome Institute

Washington University

CircRNA

chr11|59639047|59654072|-|PATL1|ENST00000300146.9

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9586

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

18

Peptide

LQSQAPMFRPDTTHLHPQHR

Amino Acids from 5' Exons

DGGDVHGNTRTSADSPSSPGQANLYTYKPSVPLFSLCPAETELAGDKTA,TEVMFMATRELLRIPQAALAKPISIPTNLVSLFSRYVDRQKLNLLETKL,RRCSWQHENFCGFPKQPWPSQSLYLQTCPSFLAMLTGRNTCWRQNC

Amino Acids from 3' Exons

ISGPNVTGHNSPPSTAPSTLASETATEK,SQAPMFRPDTTHLHPQHRRLLHQRQQQNR,LRPQCLDRTQLTSIHSTVDSCIRDSNRIE