McDonnell Genome Institute

Washington University

CircRNA

chr11|57808389|57809466|+|CTNND1|ENST00000358694.10

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.919

12

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

11

2

Peptide

SGMVDTSALLCVK

Amino Acids from 5' Exons

YGRYIRSALRQEKALSAIADLLTNEHERVVKAASGALRNLAVDARNKELI,MVDTSALLCVKRRLFLPLTSLMNMNGWKLHLEHETWLWMLATKNL,WSIHPLCSASREGSFCHSPPDTTGGESCIWSTEKPGCGCSQQRIN

Amino Acids from 3' Exons

VNMLFLTWRICQEDSRTPLGISLRTLSSLFTLSTRLSLRTWRLPKSFERHRVLRSWCSTNQ,TCYSLGKESARRTAELLLEFLGHCHLYFEHYQRGYRELGGCQKASRDTGYEAGVDQQIR,KHAIPNLVKNLPGGQQNSSWNFSEDTVISILNTINEVIAENLEAAKKLRETQGIEKLVLINKS