McDonnell Genome Institute

Washington University

CircRNA

chr11|57801732|57809466|+|CTNND1|ENST00000358694.10

Cancer

Type of Peptide

OSCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9554

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

25

2

Peptide

SGSYEDMIGEEVPSDQYYWAPLAQHER

Amino Acids from 5' Exons

ELRHDWGGAIGSILLGSFGPAARKFSKLGPAQRRASTSLETARAARGDRHAWIPLGCCQVQCSCIPATLMLPQQGEDRAEAQGHPSTGGIVRPSQKGSAPWSLWSSQEYLFWTPGQDCHKKLWCACPCAIASKGSYGPYSYY,SYEDMIGEEVPSDQYYWAPLAQHERGSLASLDSLRKGGPPPPNWRQPELPEVIAMLGFRLDAVKSNAAAYLQHLCYRNDKVKTDVRKLKGIPVLVGLLDHPKKEVHLGACGALKNISFGRDQDNKIAIKNCDGVPALVRLLRKARDMDLTEVIT,AMKTLVRRCHRINTTGLLWPSMSEEVQAWIACAKEGLHLLIGDSQSCQRSPCLDSAWMLSSPMQLHTCNTYATAMTRRLTCGSSRASQYWWDCTIPKRKCTLEPVELSRISLLDVTRITRLPKTVMVCLPLCDCFERLVIWTLLKLLP

Amino Acids from 3' Exons

VNMLFLTWRICQEDSRTPLGISLRTLSSLFTLSTRLSLRTWRLPKSFERHRVLRSWCSTNQ,TCYSLGKESARRTAELLLEFLGHCHLYFEHYQRGYRELGGCQKASRDTGYEAGVDQQIR,KHAIPNLVKNLPGGQQNSSWNFSEDTVISILNTINEVIAENLEAAKKLRETQGIEKLVLINKS