McDonnell Genome Institute

Washington University

CircRNA

chr11|57795576|57810223|+|CTNND1|ENST00000358694.10

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9097

26

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

12

4

Peptide

SDFQDHSHLLYSTIPR

Amino Acids from 5' Exons

DHSHLLYSTIPRMQEPGQIVETYTEEDPEGAMSVVSVETSDDGTTRRTETT,ITVTFYIAPSPGCRSRGRLWRPTRRRILREPCLSLWRPQMMGPLGAQRP,SQSPSIHHPQDAGAGADCGDLHGGGSGSHVCSLCGDLRWDHSAHRDH

Amino Acids from 3' Exons

EPLRKRSSSSSTCITDNLGIGTAEATGKRRMEEIRLS,NRSEKEVRAAALVLQTIWGYKELRKPLEKEGWKKSDFQ,TAQKKKFEQQHLYYRQSGDIRNCGSHWKKKDGRNQTF