McDonnell Genome Institute

Washington University

CircRNA

chr11|57312533|57321950|-|TNKS1BP1|ENST00000358252.7

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.933

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

4

Peptide

SPLSPWLPGR

Amino Acids from 5' Exons

ISKPWIPSSPAPSSENGGPASPGLPAEASGSGPGSPHLHPPDKSSPCHSQLLEAQTPEASQASPCPAVTPSAPSAALPDEGSRHTPSPGLPAEGAPEAPRPSSPPPEVLEPHSLDQPPATSPRPLIEVGELLDLTRTFPSGGEEEAKGDAHLRPTSLVQRRFSEGVLQSPSQDQEKLGGSLAALPQGQGSQLALDRPFGAESNWSLSQSFEWTFPTRPSGLGVWRLDSPPPSPITEASEAAEAAEAGNLAVSSREEGVSQQGQGAGSAPSGSGSSWVQGDDPSMSLTQKGDGESQPQFPAVPLEPLPTTEGTPGLPLQQAEERYESQEPLAGQESPLPLATREAALPILEPVLGQEQPAAPDQPCVLFADAPEPGQALPVEEEAVTLARAETTQARTEAQDLCRASPEPPGPESSSRWLDDLLASPPPSGGGARRGAGAELKDTQSPSTCSE,FPSPGFPQVQPPPQRMEALPAQASPQKPQAQALALPIFTRLIRVLPATHSFWKPRLLKLPRLLPAPLLHQLQVQPCLTRAPATPPARGSLPRGLQRPPDPAAHPLRSWSPIAWISPLPPHPGPSRWVSCWISLGRFHLAGRRRPRVTHTSAPPAWFSADSLKVCSSHPVRTRRSWGARWLPCPKARGASWPWIVPLGQSPTGAYHSPSNGPSPRGPRVWACGGWTPRLPPPSLKPVRPPRLLRLATWPFPAGKKECLSRGKGLGQLQVGQEVPGCRGMIQACPSPRRAMGRVNLNSQLFPLSPCLQLRAHLDYLCSRQRRDTSRRSPWLDRSPLSPWLPGRQPCPSWSQSWGRSSQQPLTSPVFSLLMPLSLDRHCLLRRRPPPGLRPPKPGQRLKTCVGHPPSLQALKAAPAGWTTSWLHHHPVVAVQGGELELSRTHSPQVPAL,FQALDSLKSSPLLREWRPCQPRPPRRSLRLRPWLSPSSPAEFSLPLTASGSPDSSFPGFSLPRCDSISSKCSPARGLPPHPQPGAPCRGGSRGPQTQQPTPGLGAPPGSAPCHLTPAPDRGGVAGSHSDVSIWRGGGGQGRTPPPHQPGSAPILRCAPVTQSGPGEAGGLAGCPAPRPGEPVGPGSSLWGRVQLELITVLRMDLPHEALGSGRVAAGLPASLPHHSQGRRGCGWQLGRFQQGRRSVSAGARGWVSSKWVRKFLGAGGSKHVPHPEGRWGESTSIPSCSPAPAYNGHTWITFAAGRGEIRVAGALGWTGVPSPPGYQGGSLAHPGASPGAGAASSPPALCSLCCPAWTGTACGGGRDPSPGDHPSQDRGSRLVGIPRASRPKQLPLAGRPPGFTTTQWWRCKAGSWSAEGHTVPKYLL

Amino Acids from 3' Exons

VCSHPSSYLSASPLSRRVCRMKCLLSGKAQPWLPHCPGRWRRSWCLLALSQ,SAATPAHTSLPPRSQGGSAACDESVYSQGKLSHGFPTAPGDGGGAGAYWLA,LQPPQLIPLCLPALKEGLPHVMKVSTLRESSAMASPLPREMEEELVPTGSEP