McDonnell Genome Institute

Washington University

CircRNA

chr11|5226619|5226799|-|HBB|ENST00000380315.2

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9902

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

10

Peptide

GTFATLSELLVVYPWTQR

Amino Acids from 5' Exons

AAGGLPLDPEVLVLWGSVHSCCYGQPGEGSWQESARCLWPGSPGQPQGHLCHTE,LLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLS,CWWSTLGPRGSLSPLGICPLLMLLWATLRRLMARKCSVPLVMAWLTWTTSRAPLPHV

Amino Acids from 3' Exons

AAGGLPLDPEVLVLWGSVHSCCYGQPGEGSWQESARCLWPGSPGQPQGHLCHTE,LLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLS,CWWSTLGPRGSLSPLGICPLLMLLWATLRRLMARKCSVPLVMAWLTWTTSRAPLPHV