McDonnell Genome Institute

Washington University

CircRNA

chr11|47803437|47806312|-|NUP160|ENST00000378460.6

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9224

7

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

16

Peptide

TEVSSPQTIVELFFQEVAR

Amino Acids from 5' Exons

DYIQLLHPWCQVNVGSCRFMLGRCYLVTGEGQK,IIFNCYIPGVKSMLVPVDLCWEGVTLQEKDR,LYSTATSLVSSQCWFLSIYAGKVLPSYRRRTE

Amino Acids from 3' Exons

YLVLRLLWSYSSKKLQENTLYLTSSLSQRHLAKLDIGLKLLQLPVIYCSF,ISSDYCGVILPRSCKKTHYISPLLSAKGTSEPNWIELANDYCNYQLFIAAF,SSPQTIVELFFQEVARKHIISHLFSQPKAPLSQTGLNWPEMITAITSYLLQL