McDonnell Genome Institute

Washington University

CircRNA

chr11|47259790|47262018|+|NR1H3|ENST00000481020.5

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9694

8

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

14

Peptide

FAACVQVMLLETSR

Amino Acids from 5' Exons

TLRWSCGSQAHRMQAARPREAAAASSERKPGCPTLLGVLQGWGWRLQSPQPCSPGQSPLQNPQ,LCGGAVEARRTGCKQPGPGRQQLHPQRGSQDAPLCWGYCRGGAGGCRAHSPAHQGRAPFRTH,SAVELWKPGAQDASSQAQGGSSCILREEARMPHSAGGTAGVGLEAAEPTALLTRAEPPSEPT

Amino Acids from 3' Exons

PWPMAPDPHSREARQQRFAHFTELAIVSVQEIVDFAKQLPGFLQLSREDQIALLKTSAIEVAGEGQGMKGEAEWDYLWEGPPDIELGEPNLLGSRDEENRPPWKRPCSKTSPPSPRLRFAACVQVMLLETSRRYNPGSESITFLKDFSYNREDFAKA,LGPWHQIPIAGRPVSSALPTSLSWPSSLCRRLTLLNSYPASCSSAGRTRLPCRPLRSRWLEKGKGREKQSGIICGRGLQTSSWESQICWEAGMRRIGLPGRGHAPRPALLVPVGLLLVCRCFWRHLGGTTLGVRVSPSSRISVITGKTLPKQ,LAHGTRSPPGGPSAALCPLHAGHRLCAGDSLCTATRLPAAQPGGPDCPAEDLCDRGGWRRARDEGRSRVGLSVGGASRHRAGRAKSAGKQGGESASLEEAMLQDQPSSPFEVCCLCAGDASGDISEVQPWEEYHLPQGFQLPGRLCQS