McDonnell Genome Institute

Washington University

CircRNA

chr11|47166267|47171800|-|ARFGAP2|ENST00000395449.7

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9614

25

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

13

4

Peptide

MAVLANGVMNSLQLGAK

Amino Acids from 5' Exons

EVYLWGTCCLQRTLPSLSRVSSLWLGKWLCWPMVIPC,KCISGERAAYSGHCPVAGCQVCGWENGCAGQWCDEFLA,SVSLGNVLPTADIAQFKQGVKSVAGKMAVLANGVMNSLQ

Amino Acids from 3' Exons

LGAKKGLGAQKVSSQSFSEIERQAQVAEKLREQQAADAKKQAEES,WVPRKAGPRRAARASVRLSGRLRWQRSSVSSRQPMPRSRRRSP,GCQERPRGPEGEQPELQDAAGSGGREAPAAGSRCQEAGGGVH