McDonnell Genome Institute

Washington University

CircRNA

chr11|46876465|46877339|-|LRP4|ENST00000378623.5

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9928

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

2

Peptide

LMPLAGK

Amino Acids from 5' Exons

GYRPQMGSRLMPLAGKYTGQTREQTGLKWATWTGPCGKCWCGRTLTVPGPSYCTMRW,ATDHRWARGCHWPESILDRHGNKPDSGQPGRVHAESVGVAEPQSPGHRTVPDG,LQTTDGLAVDAIGRKVYWTDTGTNRIEVGNLDGSMRKVLVWQNLDSPRAIVLYHEM

Amino Acids from 3' Exons

ATVSSSSPGGTFAWSPWTSLILLMWWYQSTLPRTPLPLETPRK,HEQFPHLRQEDRHSHGLPGHPLFCCGGTNQHYHEEHHCHWSRPPG,MNSFLIFARRIDIRMVSLDIPYFADVVVPINITMKNTIAIGVDPQE