McDonnell Genome Institute

Washington University

CircRNA

chr11|46809741|46818503|-|CKAP5|ENST00000312055.9

Cancer

Type of Peptide

OSCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9623

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

3

Peptide

LLVEMLK

Amino Acids from 5' Exons

LKELEEEWVKLPTSAPRPTRFLRSQQELEAKLEQQQSAGGDAEG,KNKKNGSNCQQVLLDLLDFFVPNKNKLNWNNNSLLVEMLKE,ERTRRRMGQTANKCSTYSISSFPTRTRSIGTTTVCWWRCR

Amino Acids from 3' Exons

LWKARLSGYEEALKIFQKIKDEKSPEWSKFLGLIKKFVTDSNAVVQLKGLEAALVYVENAHVAG,CGKQGVGMKRPRSSRKRMKRAQSGPNFDSKNLSLIPMQWFNKDKLHLFMLKMPMQE,VESKVKWVRGPEDLPENKGKEPRVVQIFRIDQKICHFQCSGSIERIRSCTCLCKCPCSRK