McDonnell Genome Institute

Washington University

CircRNA

chr11|46795593|46809874|-|CKAP5|ENST00000312055.9

Cancer

Type of Peptide

PRAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.99

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

3

Peptide

KAPAAKLK

Amino Acids from 5' Exons

IKECSEKVELIHGKKAGLAADKKEFKPLPGRTAASGAAGDKDTKDISAPKPGPLKKAPAAK,SKNVQKRNYMVRKLDLLIRRNSNLCLEGLLLQGLQEIRTQRTFLHPNQDLKRHLLL,QRMFRKGRTDTWESWTSCEGIQTSAWKDCCFRGCRRGHKGHFCTQTRTSKKGTCC

Amino Acids from 3' Exons

LKELEEEWVKLPTSAPRPTRFLRSQQELEAKLEQQQSAGGDAEG,KNKKNGSNCQQVLLDLLDFFVPNKNKLNWNNNSLLVEMLKE,ERTRRRMGQTANKCSTYSISSFPTRTRSIGTTTVCWWRCR