McDonnell Genome Institute

Washington University

CircRNA

chr11|46765130|46790583|-|CKAP5|ENST00000312055.9

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9408

9

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

6

Peptide

GLKAGGPPK

Amino Acids from 5' Exons

SAQGKKMPSKTSLKEDEDKSGPIFIVVPNGKEQRMKDEKGLK,VHKGRRCQAKPARRMKTNPGLFLLLFQMEKSKGKMKKD,CTREEDAKQNQLKGGRQIRAYFYCCSKWKRAKDERKRIE

Amino Acids from 3' Exons

AGGPPKKGKPAAPGGAGNTGTKNKKGLETKEIVEPELS,LVGHQKRGNQLHQEAQGILEPRTRKDWRLKKWSLSS,WWATKKGETSCTRRRREYWNQEQERTGDRNSGAAL