top of page

McDonnell Genome Institute

Washington University

CircRNA

chr11|46754887|46790583|-|CKAP5|ENST00000529230.5

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9328

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

11

6

Peptide

LYSCIIGNMISAGGPPK

Amino Acids from 5' Exons

IDEVLRQEDKAEAMSGHIDQFLIATFMQLRLIYNTHMADEKLEKDEIIKLYSCIIGNMIS,SMRSDRKTKLKPCPAILISFPLLCSDSSTTHTWQMRNWRRTRSSSCIAVSLATF,RGPETGRQSSHVRPYSVSDSHFYAAKTHLQHTHGREIGEGRDHQVVLYHWQHDF

Amino Acids from 3' Exons

AGGPPKKGKPAAPGGAGNTGTKNKKGLETKEIVEPELS,LVGHQKRGNQLHQEAQGILEPRTRKDWRLKKWSLSS,WWATKKGETSCTRRRREYWNQEQERTGDRNSGAAL

bottom of page