McDonnell Genome Institute

Washington University

CircRNA

chr11|46754887|46763630|-|CKAP5|ENST00000529230.5

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.98

13

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

11

3

Peptide

LYSCIIGNMISVLK

Amino Acids from 5' Exons

IDEVLRQEDKAEAMSGHIDQFLIATFMQLRLIYNTHMADEKLEKDEIIKLYSCIIGNMIS,SMRSDRKTKLKPCPAILISFPLLCSDSSTTHTWQMRNWRRTRSSSCIAVSLATF,RGPETGRQSSHVRPYSVSDSHFYAAKTHLQHTHGREIGEGRDHQVVLYHWQHDF

Amino Acids from 3' Exons

VLKWNFTTPRDEYIEQLKTQMSSCVAKWLQDEMFHSDFQHHNKALAVMVD,CSGILLPHGMNTLSNRLKCLAVWLNGYKMRCFTQTFSIITKPLLLWL,AKVEFYYPTGIHATKDSNVLCGMVTRDVSLRLSASQSPCCYG