McDonnell Genome Institute

Washington University

CircRNA

chr11|46754887|46760784|-|CKAP5|ENST00000529230.5

Cancer

Type of Peptide

OSCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9057

8

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

11

4

Peptide

LYSCIIGNMISLSEK

Amino Acids from 5' Exons

IDEVLRQEDKAEAMSGHIDQFLIATFMQLRLIYNTHMADEKLEKDEIIKLYSCIIGNMIS,SMRSDRKTKLKPCPAILISFPLLCSDSSTTHTWQMRNWRRTRSSSCIAVSLATF,RGPETGRQSSHVRPYSVSDSHFYAAKTHLQHTHGREIGEGRDHQVVLYHWQHDF

Amino Acids from 3' Exons

LSEKDMSMLEERIKRSAKRPSAAPIKQVEEKPQRAQNISSNANMLRKGPAEDMSSKL,FLKRIACSRRGLSGQQRDPLLHQNRWKRNLSVHRTAPMPTCYARDQLRTCLPNS,FKGYEHARGEDAVSKETLCCTNKTGGRETSACTEHKLQCQHVTQGTSGHVFQTQ