McDonnell Genome Institute

Washington University

CircRNA

chr11|45926221|45927593|+|GYLTL1B|ENST00000325468.9

Cancer

Type of Peptide

BRCA-Luminal B

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9968

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

20

Peptide

LTSSSVTLTSCLPILSTTTSGHLQR

Amino Acids from 5' Exons

DIFNAVIKEHPGLVQRLPCVWNVQLSDHTLAERCYSEASDLK,TSSTLSRSTRGCSVCLVSGMCSCQITHWPSAATLRRLTS,HLQRCDQGAPGASAASALCLECAAVRSHTGRALLLGVPQ

Amino Acids from 3' Exons

AADVGSPVQALAWPHEPGLVPDRRRSSAVPAFRRGLTSACCPAGRGLPCGVPGAPIPRQPASQRGLGPGPHALRLPQHLPACLFSLRLPQ,LQMLEALCRHWPGPMSLALYLTDAEAQQFLHFVEASPVLAARQDVAYHVVYREGPLYPVNQLRNVALAQALTPYVFLSDIDFLPAYSLYDYL,CRCWKPCAGTGLAPAWPCTQTQKLSSSCISSRPHQCLLPGRTWPTMWCTVRGPYTPSTSFATWPWPRPSRLTSSSVTLTSCLPILSTTTS