McDonnell Genome Institute

Washington University

CircRNA

chr11|45181760|45183123|+|PRDM11|ENST00000424263.6

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9708

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

8

Peptide

SAGFFSWLDR

Amino Acids from 5' Exons

DRMTENMKECLAQTNAAVGDMVTVVKTEVCSPLRDQEYGQP,TEPRTRSAWPRPMQPWGIWRWRRRSAHHSETRSMASP,QNDREHEGVLGPDQCSRGGYGDGGEDGGLLTTPRPGVWPAL

Amino Acids from 3' Exons

SVSPARSTSWMNAQTMAPRCLCLTHRCPWASQTGRRSPSHRAWRWSRTLVERVTCDVTRSSPRATSSAPMRGRSPPRTNQLASSPG,LVLPGVLRGMPKPWPPGVCVHTGARGHPRPGGAHHPTGHGGGQGHWRERAMCKRGHPQGPHLRPLGADLHPGQISWLLLLA,CESCQEYFVDECPNHGPPVFVSDTPVPVGIPDRAALTIPQGMEVVKDTSGESDVRCVNEVIPKGHIFGPYEGQISTQDKSAGFFSWL