McDonnell Genome Institute

Washington University

CircRNA

chr11|43405785|43436334|+|TTC17|ENST00000299240.10

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

15

Peptide

GTEEDPVFSVENSGR

Amino Acids from 5' Exons

DPRTQQLFYRRRGPNPLFHNLQKKPHSVLLSQRIRGSHGSESQNARPCTK,IHELSSDDYSTEEEAQTPDCSITDFRKSHTLSYLVKELEVRMDLKAKMPDDHARK,STNSAVMIILQKKRPKPLTVPLTSEKATLCPTSKNRFAWIKPKCQMTMHE

Amino Acids from 3' Exons

VIVMRKPWTTAMTNRNILTTHSHWMLLKKSPLREEQRRTLYSLLRIQGGTQMPLDLK,LSENPGQQPQTEIFQLTVTGCCRRALERNRGGPCILCEFREGLRCPT,NCHEKTLDNSHDKQKYFDNSQSLDAAEEEPSERGTEEDPVFSVENSGRDSDALRLE