McDonnell Genome Institute

Washington University

CircRNA

chr11|4106045|4107535|+|RRM1|ENST00000300738.9

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9611

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

2

Peptide

DAQITMK

Amino Acids from 5' Exons

AQITMKVIQGLYSGVTTVELDTLAAETAATLTTKHPDYAILAARIAVSNLHKETKKVFS,LRSPKSKACTVGSPQWNILWLLKQLQPLLSTLTMLSWQPGSLSLTCTKKQRKCSV,SDHHESNPRLVQWGHHSGTRYFGCNSCNLDYAPLCYPGSQDRCLLAQRNKESVQ

Amino Acids from 3' Exons

MWKTSITTIHIMANTLPWWPSQHWILFWPIK,CDGRPLLHKSTWQTLSHGGQVNIGYCSGQR,VMEDLYNYINPHNGKHSPMVAKSTLDIVLANKD