McDonnell Genome Institute

Washington University

CircRNA

chr11|4083262|4086543|+|STIM1|ENST00000300737.8

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9944

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

12

11

Peptide

LTEPQHGLGSQRQALSEVTAALR

Amino Acids from 5' Exons

ASTERGDSSIAGAPAPLATDRDPLWLPDCQQPWHPLTGGCPQHRPQLDGQYTPQPCSLHHDRRGHGGDCVSLVHA,QALSEVTAALRERLHRWQQIEILCGFQIVNNPGIHSLVAALNIDPSWMGSTRPNPAHFIMTDDVDDMDEEIVSPLSMQ,KHARQQHCGSACTAGNRSRSSVASRLSTTLASTHWWLPSTTPAGWAVHAPTLLTSSLTTWMTWMRRLCLPCPCS

Amino Acids from 3' Exons

PLACRAVFGSARSHSMAWDLR,PPAEQCSAAPDGATAWPGISE,PSLQSSVRQRLTEPQHGLGSQ