McDonnell Genome Institute

Washington University

CircRNA

chr11|3705199|3720825|-|NUP98|ENST00000324932.11

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9475

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

5

Peptide

SLGIILTK

Amino Acids from 5' Exons

IMKASLLTDEEDVDMALDQRFSRLPSKADTSQEICSPRLPISASHSSKTRSL,SKHHCLLMKKMIWHWINASVACLPKQILLKKSVLPDSPFQHPTRRKLVH,HESIIAYRRCRYGTGSTLQSPAFQSRYFSRNLFSQTPHFSIPLVENSFT

Amino Acids from 3' Exons

VLFSLRLVTILFHLWMTLLKLPMKKESALSLISLLVGK,YYSHGWLLYYSIYGPCNYQKRRVHCLFHYWSE,IILTKVGYYTIPSMDDLAKITNEKGECIVSDFTIGRK